digg

Join DiggAbout

The Digg Crew wants to hear your thoughts!
Please take our short survey about Digg and potential feature ideas.

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch Station...[pic]

upload.wikimedia.org — um, just look.

show profanity settings
expand all
  • cosmikdebris, on 10/10/2007, -2/+222"The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave". Llanfairpwll is on the island of Anglesey (called Ynys Môn in Welsh). It is separated from the Wales mainland by the Menai Straits. Useless trivia, the village name was used in the 1960's cult film Barbarella as the password for Dildano's headquarters.
    • 4850lu73, on 10/10/2007, -3/+29And I live there :D diolch!
      • cosmikdebris, on 10/10/2007, -2/+12Croeso
      • WalesAlex, on 10/10/2007, -3/+15Croeseo i Gymru fy ffrindiau.
        • sabach, on 10/20/2007, -10/+5Ramalamadingdong awopbabaloobopalopbamboom.
      • cosmikdebris, on 10/20/2007, -0/+11Translation "Welcome to Wales, my friends." WalesAlex: We don't want them to think that we're talking behind their backs!
    • frenchyooy, on 10/10/2007, -1/+21I think it's right next to "The church of St. Mary in the hollow of BROWN hazel trees near the rapid whirlpool by St. Tysilio's of the BLACK cave" . Sometimes, you have to be precise to avoid confusion.
    • Stonekeeper, on 10/20/2007, -0/+3That's nothing. I live in a place called Blaenau Ffestiniog! Glyn to win!!! oh.... er... nevermind....
    • radam, on 10/20/2007, -0/+8Dugg for the most unique movie trivia sidenote I've heard all year.
    • steamedlice, on 10/10/2007, -0/+3Knew I recognized the name as soon as I read "...gogogoch".
    • Kitsune818, on 10/10/2007, -0/+1Your mission Barbarella: Find Duran Duran

      Majordomo!
      • SeriousSnowman, on 10/10/2007, -0/+0say marjordomo;

        You say "majordomo"
        A hollow voice says "You have explored 20% of the world"
  • TunerPrep, on 10/10/2007, -16/+251lol. thanks. it wasnt to hard because all I did was copy and paste from the actual webpage title. but thanks.
    • mablco, on 10/10/2007, -8/+169and he throws it away with a too/to blunder
      • usherzx, on 10/10/2007, -3/+51Damn, I love the comedy on Digg.. It doesn't get any better any where else
        Thanks mablco

        and all you other smartass knuckle heads that make my day - every day
    • norbiu, on 10/10/2007, -3/+81And by not using the REPLY function.
  • kalhey, on 10/10/2007, -84/+6totally dugg for accurate title
    • will4042, on 10/10/2007, -6/+17already said
      • edesignweb, on 10/10/2007, -13/+3it's so weird, cuz you must be like the repeat police. You actually took the time to comment and let this person know that they are saying the same thing that someone else said. you are such a douchebag. i've always disliked people named will.
        • theBIGGESTsmurf, on 10/10/2007, -3/+2my names will..........
          • sabach, on 10/10/2007, -3/+2Your names will what? What will they do, hmmm?
        • mikesbaker, on 10/10/2007, -0/+3and you took the time to flame him so who is the real douche here?
    • brokentone, on 10/10/2007, -4/+2totally buried for duplicate comment
    • Frnnkdlxx, on 10/10/2007, -5/+2you guys are jackasses and jerks! lol. but since humans are by nature followers, i'll digg him down as well. BURRNT!
  • zenlunatic, on 10/10/2007, -58/+4Typo!
  • zenlunatic, on 10/10/2007, -52/+10How many times must I tell you not to drink and submit?
  • secretwhistle, on 10/10/2007, -6/+426"Yeah, Pat. I'd like to buy a vowel...


    all of them..."
    • u8myfoood, on 10/10/2007, -5/+107Actually Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch does not contain an "U"
      • Emilio8605, on 10/10/2007, -2/+30Is that AN "U", or A "U"?
        • elnerdo, on 10/10/2007, -1/+30A "U"
        • h0dg3s, on 10/10/2007, -15/+1An U. It sounds weird, but you precede all vowels with "an".
          • xxpor, on 10/10/2007, -0/+26no you dont, you precede all vowel SOUNDS with an "an"
      • Ratty, on 10/10/2007, -0/+22In Welsh, W is a vowel and often used in places where you'd see a U. e.g. "bus" in Welsh is "bws". The Welsh alphabet is quite a bit different from the the English one even though the character set is the same.
        • Stonekeeper, on 10/10/2007, -0/+6you forgot to mention that Welsh also has "double character" letters such as ll,rh,dd,ff,ch.....er..... i'm sure there's more ;)
          • nosecohn, on 10/10/2007, -0/+4What's with the quadruple 'l' in that name?
        • Andrej73, on 10/10/2007, -2/+2pwned!!
          I speak Welsh.
    • f8pc, on 10/10/2007, -24/+2Actually, the title is not correct. Only the first couple and last letters are accurate. Look at the picture again, there is a "U."
      • thatsoccerchick, on 10/10/2007, -0/+17that's the pronunciation... the top line is the actual name
    • aliguana, on 10/10/2007, -1/+5we don't need no steenkin vowels...
      • u8myfoood, on 10/10/2007, -1/+19Yes, you do because "W dn't nd n stkng vwls..." doesn't seem to have the same effect.
        • Ragzouken, on 10/10/2007, -0/+31It does, however, look like Welsh.
    • SocialPoison, on 10/10/2007, -6/+1First digg comment I've busted out laughing over in a long time...
    • hiro, on 10/20/2007, -1/+4Pat? Do you mean Carol?
      • Eastlygod, on 10/20/2007, -0/+3Someone's getting Countdown confused with Wheel of Fortune...

        Now make sure you revise you're cheesy quiz shows next time, they'll be a pop quiz on Tuesday.
  • ScrumFritter, on 10/10/2007, -19/+5The Welsh sure hate their vowels...
    • brucesan, on 10/10/2007, -0/+9Actually in Welsh, the letters A E I O U Y W are all considered vowels.
      • Audacitor, on 10/10/2007, -0/+3An example of their W in action is:
        Cwrw!



        That's the welsh word for beer! ^^
        • DavidtheDuke, on 10/10/2007, -0/+2How the hell do you pronounce cwrw!?
        • DaffyDuck, on 10/10/2007, -1/+1I'll have a go at it.

          Barmaid, gimme a Ka-woo-er-woo!
      • ScrumFritter, on 10/10/2007, -0/+2Well, shucks, colour me corrected!
  • wiifm69, on 10/10/2007, -4/+242Longest place name in the world: Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu, which is Maori for "the place where Tamatea, the man with the big knees, who slid, climbed and swallowed mountains, known as 'landeater,' played his flute to his loved one."
    • veracon, on 10/10/2007, -1/+30I prefer the Thai name of Bangkok: Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Ayuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit

      Which translates to: The city of angels, the great city, the eternal jewel city, the impregnable city of God Indra, the grand capital of the world endowed with nine precious gems, the happy city, abounding in an enormous Royal Palace that resembles the heavenly abode where reigns the reincarnated god, a city given by Indra and built by Vishnukam
    • fluffyllemon, on 10/10/2007, -3/+0Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu is longer. It's actually the same place. Wikipedia told me so.
    • DopeWeasel, on 10/10/2007, -2/+4http://en.wikipedia.org/wiki/Image:New_Zealand_0577.jpg
    • kcmedic, on 10/10/2007, -4/+4Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit is longer.
    • xShad0w, on 10/10/2007, -5/+7Sounds like something they would say in family guy, "the place where Tamatea, the man with the big knees, who slid, climbed and swallowed mountains, known as 'landeater,' played his flute to his loved one."
    • BlackBladeX, on 10/10/2007, -2/+0The fullname of Bankok is 163 letters. This one is pretty cool though.
    • gcnaddict, on 10/10/2007, -3/+1According to notepad (with static character sizes), Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu is one letter shorter than Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

      So I don't know which pipe you're smoking.
    • Jesusridesabike, on 10/10/2007, -3/+1why cant these people jsut give places a name?
    • Machismo, on 10/10/2007, -2/+17I just named my apartment Tethrotozolloperpolloyquesowithasideofraspberriesandspiderorchardsinthemiddleofabowlofsulfuerouswaterparkstethrotozolloper-
      polloyquesowithasideofraspberriesandspiderorchardsinthemiddleofabowlofsulfuerouswaterparkstethrotozolloperpolloyquesowith-
      asideofraspberriesandspiderorchardsinthemiddleofabowlofsulfuerouswaterparks. So I now have the longest place name in the world.
    • RockinRoel, on 10/10/2007, -0/+2"played his flute to his loved one"
      I wonder what that could mean...
  • Azimuth1, on 10/20/2007, -5/+23I went there several years ago, nice place.
    • Wartyboskfapped, on 10/20/2007, -1/+7I've been there too. Can't say it.
      • psylence, on 10/10/2007, -3/+1Did you burst into flames?
        • Dracker, on 10/10/2007, -0/+2no but my trailer got burned down by some Welsh guy on the internet.
    • blacklint, on 10/10/2007, -0/+5I was just there as well. They were genius picking that name for the town - my tour bus went there just because of it.
    • Ohnodonho, on 10/10/2007, -0/+4I have been as well. There were a few kids (no older than 13) riding around "throwing" (for lack of a better word) rude gestures at us while we left.
    • Frnnkdlxx, on 10/10/2007, -1/+1liars
    • Bruno43, on 10/10/2007, -0/+2Been there also, Llanfair PG, when I was there kids drove by squirting us with water guns
  • jmpeagle, on 10/10/2007, -13/+2is that a phonetic spelling underneath the place name?
    • godamit, on 10/10/2007, -11/+2yep, it's an old irish or english, dunno, and that below is how it is spelled
    • clarkd, on 10/10/2007, -11/+9No, it's an alternate spelling. WTF do you think it is?
      • jmpeagle, on 10/10/2007, -0/+5I don't know, but why would the phonetic spelling start the word out with two L's in a row.
        • brucesan, on 10/10/2007, -0/+4Because in well two Ls next to each other produces a different phonetic sound. LL is a single letter in the welsh alphabet. As is dd and ch.
        • Azimuth1, on 10/10/2007, -0/+3Because it's not phoneticised for English speakers, it's phoneticised for Welsh speakers.
    • drlha, on 10/10/2007, -2/+3Correct.
    • mablco, on 10/10/2007, -1/+7no....it just looks that way........
    • Tippis, on 10/10/2007, -0/+4Now compare that to what Opera spits out if you use the "voice" command ;)
    • cypherspace, on 10/10/2007, -0/+5It's supposed to be phonetic but it's not actually that accurate. There are better approximations!
  • Thorpe, on 10/20/2007, -4/+77This title totally didn't like the Digg Google IG module. :(
    • imablackguy, on 10/20/2007, -0/+2This title totally didn't like my cramped width=40 rss feed either.
  • TimeIsTissue, on 10/10/2007, -37/+15... But will it blend?
    • chrismccorkle, on 10/10/2007, -5/+3Why this comment is buried... no idea. Nice one
  • canha, on 10/10/2007, -16/+2what does it mean? where is it from?
  • uptown, on 10/29/2007, -6/+385Damn cat on the keyboard again....
  • SaviourSelf, on 10/10/2007, -5/+26Did they charge per letter?
  • Threlly, on 10/10/2007, -24/+16I have this tattooed on my *****
    • cosmikdebris, on 10/20/2007, -0/+10As it is locally known you may be able to fit on. Llanfairpg!
    • mablco, on 10/20/2007, -0/+33did you have to go to that name on a grain of rice place?
    • hiro, on 10/20/2007, -0/+4"I have this tattooed on my *****"

      t-h-i-s

      Yep, it'll fit sir
  • Torx, on 10/10/2007, -14/+7"go-ger-u-queern-drob"
    translates to "go girl, you queer drob"
  • tumples, on 10/10/2007, -16/+3Nice name but front page worthy? So much crap is getting thrown onto this site nowadays, usually with the caption [PIC] after it.
  • omnitrick, on 10/20/2007, -12/+151thisistheawesomestmostbestestsignihaveeverseeninmyentirelife
  • Adrianc333, on 10/10/2007, -38/+5Another image: http://farm2.static.flickr.com/1284/918404356_4e0cf6af15.jpg?v=0
  • godamit, on 10/10/2007, -9/+2Any shortcut, please?

    Maybe Llanfairpwllgwygogoch or something?
    • EvilJelloMan, on 10/10/2007, -1/+0how about Lelu?
    • meatmcguffin, on 10/10/2007, -0/+2LLanfairpg is the common shortening and even that's longer than most city names
    • meatmcguffin, on 10/10/2007, -1/+8Seeing as Digg gave me a double post, have a wikipedia entry on the glory that is Pot Noodles

      http://en.wikipedia.org/wiki/Pot_Noodles
    • pritch, on 10/10/2007, -0/+2Llanfairpwll is what the locals call it, and is how many of the roadsigns (the non-touristy ones) have it.
  • Dekken, on 10/10/2007, -7/+2I was there once, I didn't have the slightest clue of wtf it was though.
  • theheyes, on 10/10/2007, -0/+44Been there, nice place. Ironically its a small place. Theres also a pub across the road from the train station that has a sign the full length of the building to accomodate the name. A lot of people just say "Llanfair P. G." for obvious reasons.
  • ussr2003, on 10/10/2007, -7/+1I like how they tell us the way out.
  • AirRaven, on 10/10/2007, -6/+60God bless the Welsh.
    • WalesAlex, on 10/10/2007, -25/+6***** you.
      • FunkyNuts, on 10/10/2007, -0/+5LOL...got some hostility in ya?
        • JustGrant, on 10/10/2007, -0/+0Oh........ The welsh guy is just upset because it's always been known that Welsh folk have a thing for sheep.
    • cosmikdebris, on 10/10/2007, -2/+17We don't need any blessing from God. Welsh by birth, blessed by nature!
    • ThirdPrize, on 10/10/2007, -2/+3Has anyone cracked any sheep jokes yet?
    • EdwardsNH, on 10/10/2007, -1/+1Thanks :) No one ever conquered the Welch. They just eventually teamed up with us. Best damn archers ever.
  • funkmachine, on 10/10/2007, -50/+4Speak ***** English.
  • barroni, on 10/20/2007, -2/+191I will donate beer money if Alex and Kevin use it on diggnation and get the name right
    • WalesAlex, on 10/10/2007, -3/+2It's not really that hard to learn, I learnt it in one lesson for Short Course GCSE Welsh 2nd lang lol.
      • pritch, on 10/10/2007, -0/+3But, being brought up in Wales, you'd have spent your life up to that point being exposed to Welsh pronunciations. Once you actually put together all the sounds, the Llanfaripwll... is a very easy one to say. Knowing how to make the sounds is a different matter; I've tried in vain to get my (English) colleagues to prounounce 'Ll' correctly; many of them stare in awe (I think it's awe) when they hear me talking to people back home about places like Llangyfelach and Ystradfellte.
      • ChocChunkOaties, on 10/10/2007, -0/+1I'll never trust my friend to teach me to speak Welsh again. I can't spell it in Welsh so i'll just spell it how it sounds in English...
        Tyn draa wey ti angon cowart does NOT mean: Hello, how are you? (It means You smell! You need a shower). And I also learnt not to say that as a chat up line!
    • reynish, on 10/10/2007, -2/+1I'll buy them a beer if this gets on the vidcast
      • essjay, on 10/10/2007, -0/+3As long as they remember that double "L"s in Welsh aren't prounounced with an "ell" sound but more a "chc" sound. Actually, I have no idea how you phonetically write the double l sound in Welsh.
        • localzuk, on 10/20/2007, -0/+4It is kinda like the beginnings of clearing your throat, as a letter.
    • fdiskit, on 10/10/2007, -0/+2I think it would be more entertaining to give them the beer BEFORE saying it in the next diggnation b/c.
  • Julz, on 10/10/2007, -2/+19lol the title of this storie broke my digg google homepage plugin
  • sandbird, on 10/10/2007, -6/+72This is why they should never let the Tasmanian Devil name places.
    • jumanji69, on 10/10/2007, -1/+1This is why they should never let Hellen Keller name places
  • AvengeX, on 10/20/2007, -4/+39Wales never fails to deliver lulz.
  • willhill, on 10/10/2007, -0/+27Here in my town we have a pretty long place name. We were even on the Today Show for it. It's our lake: Chargoggagoggmanchauggagoggchaubunagungamaugg. I'll confess, I can't spell it from memory, but at least I can say it.
    • ejde, on 10/10/2007, -0/+10"You fish on your side, I fish on my side, no one fish in the middle"
    • iambagels, on 10/10/2007, -0/+2Holy crap. People from Webster. I thought that I'd be the first one to make that reference. You guys are awesome.
  • berktt, on 10/10/2007, -8/+5The name somehow reminds me of the gnomes in Dragonlance...
  • soil, on 10/10/2007, -9/+4holy head batman
  • Julz, on 10/10/2007, -3/+28Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu:

    http://en.wikipedia.org/wiki/Image:New_Zealand_0577.jpg
    this is the longest place name in the world from new zealand
    • guyperson, on 10/10/2007, -1/+4Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit

      The longest town name in Thailand. It doesn't even fit in this comment.

      http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/
      • insomniac8400, on 10/10/2007, -0/+2But it is not one word, and therefore not a single long name.
        Krungthep Mahanakhon Bovorn Ratanakosin Mahintharayutthaya Mahadilokpop Noparatratchathani Burirom Udomratchanivet Mahasathan Amornpiman Avatarnsathit Sakkathattiyavisnukarmprasit
  • krinn, on 10/10/2007, -1/+8Wow, this long title totally messed up the page formatting on the front page
  • kindrobot, on 10/10/2007, -2/+308My password!!!!
    • oliver75482, on 10/10/2007, -1/+19May I ask how many times you have to click the forgotten password button?
      • JSchwage, on 10/10/2007, -1/+2He never has to use that button! He just goes back and looks at this picture!
    • Cov3rt, on 10/10/2007, -0/+0He uses Roboform!
  • KnightMareInc, on 10/10/2007, -0/+115hate to be the guy on the train having to announce that stop everyday.
    • AvengeX, on 10/10/2007, -1/+8They have recorded voices for a reason!!
    • cosmikdebris, on 10/10/2007, -0/+13He'd have a wail of a time. Those that can pronounce it are really proud of the fact and show off like hell!
    • PJBonoMan, on 10/10/2007, -0/+0I have a mate who is Welsh-- You'd be surprised how easily they can pronounce it, with little effort.
  • loqqq, on 10/10/2007, -2/+26Try saying that one time fast.
    • AndySomnifac, on 10/10/2007, -1/+19Hell, try saying it one time slowly.
  • cfl1497, on 10/10/2007, -16/+2Buried for being older than time itself.
  • expat001, on 10/10/2007, -15/+4But will it blend?
  • pb3623, on 10/10/2007, -3/+39The C is silent.
    • pritch, on 10/10/2007, -5/+2I'm going to be picky here; there's actually no 'c' in it. In Welsh, 'ch' (and 'll', 'ff', 'dd', 'ng', 'ph', 'rh' and 'th') are considered to be single letters.
    • keebler, on 10/10/2007, -0/+9I think it was a joke... and quite a good one at that. :)
  • JohnQPrivate, on 10/10/2007, -11/+2Now THAT pic says it all. Literally.
    • CeeJayDK, on 10/10/2007, -2/+6Dugg down for not knowing the literal meaning of the word Literally.
  • ryanwritescopy, on 10/10/2007, -16/+2That's nothing! Though easy to type, my hometown of QWERTYUIOP{}-ASDFGHJKL:"-ZXCVBNM - ? is nearly impossible to pronounce.
  • Naughtyme, on 10/10/2007, -1/+25Beh, it was originally known as Llanfair Pwllgwyngyll. In the 19th Century it was given its long name to try and develop it as a commercial and tourist centre.

    Locals know it as Llanfairpwll or Llanfair.

    Welsh commercialism - that worked to some extent.
  • GaidinTS, on 10/10/2007, -10/+3I've been there, and I have the crazy ass name stamped on my Passport.
  • brucesan, on 10/10/2007, -8/+3I live a 4 minutes drive from here. It's nothing special.
  • ZepFloyd, on 10/10/2007, -2/+17so much for Antidisestablishmentarianism or pneumonoultramicroscopicsilicovolcanoconiosis (a type of lung disease)
    • nationalist, on 10/10/2007, -0/+1call it 'pneumoconiosis'...it's not a rare disease; they are even lawyer commercials about it ("if you've been exposed to asbestos...")
    • paradigm1220, on 10/10/2007, -0/+1(black lung)
    • PotoinMan, on 10/10/2007, -0/+1my fifth grade teacher used to make us learn that word until our eyes bled.

      that bitch.
  • neonsox, on 10/10/2007, -17/+1Looks like your typical Indian (dot not feather) name such as Jaggahesebethavitarjizzamet Singhamusitakumar, or you can call him Jay when you call outsourced tech support.
    • bromac, on 10/10/2007, -2/+13So, you find a way to turn this into a racial jab, even though MANY different cultures have absurdly long names?

      You suck. No wonder you have a rough time with Indian tech support: the only thing that you remember they tell you is their name.
  • Jeddycakes, on 10/29/2007, -3/+1@iashraf

    you
    *****
    dumbass
  • shedtroll, on 10/10/2007, -7/+0WOW...that was....bizzare. I stayed there last week, that's right....I STAYED THERE! Who wants to touch me.....I SAID WHO WANTS TO TOUCH ME?
  • Fetching more discussions...
    Show 51 - 100 of 218 discussions
  •  

    Login or register to add a comment

    Create a new account or login to join in the conversation on Digg. You'll also be able to Digg stories to help promote things you like.


© Digg Inc. 2008 — Content posted by Digg users is dedicated to the public domain.
DIGG, DIGG IT, DUGG, DIGG THIS, Digg graphics, logos, designs, page headers, button icons, scripts, and other service names are the trademarks of Digg Inc.